Anti TRAPPC8 pAb (ATL-HPA041107)

Atlas Antibodies

Catalog No.: ATL-HPA041107-25

Protein Description: trafficking protein particle complex 8
Gene Name: TRAPPC8
Alternative Gene Name: GSG1, HsT2706, KIAA1012, TRS85
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033382: 95%, ENSRNOG00000022202: 96%
Entrez Gene ID: 22878
Uniprot ID: Q9Y2L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYDLNISATTPWFESYRETFLQSMPASDHEFLNHYLACMLVASSSEAEPVEQFSKLSQEQHRIQHNSDYSYPKWFIPNTLKYYVLLHDVSAGDE
• Gene Sequence: DYDLNISATTPWFESYRETFLQSMPASDHEFLNHYLACMLVASSSEAEPVEQFSKLSQEQHRIQHNSDYSYPKWFIPNTLKYYVLLHDVSAGDE
• Gene ID - Mouse: ENSMUSG00000033382
• Gene ID - Rat: ENSRNOG00000022202
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRAPPC8 pAb (ATL-HPA041107) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Zappa, Francesca; Wilson, Cathal; Di Tullio, Giuseppe; Santoro, Michele; Pucci, Piero; Monti, Maria; D'Amico, Davide; Pisonero-Vaquero, Sandra; De Cegli, Rossella; Romano, Alessia; Saleem, Moin A; Polishchuk, Elena; Failli, Mario; Giaquinto, Laura; De Matteis, Maria Antonietta. The TRAPP complex mediates secretion arrest induced by stress granule assembly. The Embo Journal. 2019;38(19):e101704.