Anti TRAPPC6A pAb (ATL-HPA043043)

Atlas Antibodies

Catalog No.: ATL-HPA043043-25

Protein Description: trafficking protein particle complex 6A
Gene Name: TRAPPC6A
Alternative Gene Name: HSPC289, MGC2650, TRS33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002043: 81%, ENSRNOG00000017468: 86%
Entrez Gene ID: 79090
Uniprot ID: O75865
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLR
• Gene Sequence: VGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLR
• Gene ID - Mouse: ENSMUSG00000002043
• Gene ID - Rat: ENSRNOG00000017468
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.