Anti TRAPPC3 pAb (ATL-HPA028408)

Atlas Antibodies

Catalog No.:
ATL-HPA028408-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: trafficking protein particle complex 3
Gene Name: TRAPPC3
Alternative Gene Name: BET3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028847: 98%, ENSRNOG00000010550: 98%
Entrez Gene ID: 27095
Uniprot ID: O43617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGE
Gene Sequence PDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGE
Gene ID - Mouse ENSMUSG00000028847
Gene ID - Rat ENSRNOG00000010550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRAPPC3 pAb (ATL-HPA028408)
Datasheet Anti TRAPPC3 pAb (ATL-HPA028408) Datasheet (External Link)
Vendor Page Anti TRAPPC3 pAb (ATL-HPA028408) at Atlas Antibodies

Documents & Links for Anti TRAPPC3 pAb (ATL-HPA028408)
Datasheet Anti TRAPPC3 pAb (ATL-HPA028408) Datasheet (External Link)
Vendor Page Anti TRAPPC3 pAb (ATL-HPA028408)