Anti TRAPPC3 pAb (ATL-HPA028408)

Atlas Antibodies

Catalog No.: ATL-HPA028408-100

Protein Description: trafficking protein particle complex 3
Gene Name: TRAPPC3
Alternative Gene Name: BET3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028847: 98%, ENSRNOG00000010550: 98%
Entrez Gene ID: 27095
Uniprot ID: O43617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGE
• Gene Sequence: PDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGE
• Gene ID - Mouse: ENSMUSG00000028847
• Gene ID - Rat: ENSRNOG00000010550
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.