Anti TRAP1 pAb (ATL-HPA044227 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044227-25

Protein Description: TNF receptor-associated protein 1
Gene Name: TRAP1
Alternative Gene Name: HSP75, HSP90L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005981: 74%, ENSRNOG00000005418: 71%
Entrez Gene ID: 10131
Uniprot ID: Q12931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIREL
• Gene Sequence: RTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIREL
• Gene ID - Mouse: ENSMUSG00000005981
• Gene ID - Rat: ENSRNOG00000005418
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRAP1 pAb (ATL-HPA044227 w/enhanced validation) – 1 Found

Koos, Björn; Moderegger, Eva Lotta; Rump, Katharina; Nowak, Hartmuth; Willemsen, Katrin; Holtkamp, Caroline; Thon, Patrick; Adamzik, Michael; Rahmel, Tim. LPS-Induced Endotoxemia Evokes Epigenetic Alterations in Mitochondrial DNA That Impacts Inflammatory Response. Cells. 2020;9(10)