Anti TRAK1 pAb (ATL-HPA005853)

Atlas Antibodies

Catalog No.: ATL-HPA005853-25

Protein Description: trafficking protein, kinesin binding 1
Gene Name: TRAK1
Alternative Gene Name: KIAA1042, MILT1, OIP106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032536: 95%, ENSRNOG00000019262: 94%
Entrez Gene ID: 22906
Uniprot ID: Q9UPV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELEDKYAECMEMLHEAQEELKNLRNKTMPNTTSRRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILET
• Gene Sequence: ELEDKYAECMEMLHEAQEELKNLRNKTMPNTTSRRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILET
• Gene ID - Mouse: ENSMUSG00000032536
• Gene ID - Rat: ENSRNOG00000019262
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRAK1 pAb (ATL-HPA005853) – 7 Found

Barel, Ortal; Malicdan, May Christine V; Ben-Zeev, Bruria; Kandel, Judith; Pri-Chen, Hadass; Stephen, Joshi; Castro, Inês G; Metz, Jeremy; Atawa, Osama; Moshkovitz, Sharon; Ganelin, Esther; Barshack, Iris; Polak-Charcon, Sylvie; Nass, Dvora; Marek-Yagel, Dina; Amariglio, Ninette; Shalva, Nechama; Vilboux, Thierry; Ferreira, Carlos; Pode-Shakked, Ben; Heimer, Gali; Hoffmann, Chen; Yardeni, Tal; Nissenkorn, Andreea; Avivi, Camila; Eyal, Eran; Kol, Nitzan; Glick Saar, Efrat; Wallace, Douglas C; Gahl, William A; Rechavi, Gideon; Schrader, Michael; Eckmann, David M; Anikster, Yair. Deleterious variants in TRAK1 disrupt mitochondrial movement and cause fatal encephalopathy. Brain : A Journal Of Neurology. 2017;140(3):568-581. 

Basu, Himanish; Pekkurnaz, Gulcin; Falk, Jill; Wei, Wei; Chin, Morven; Steen, Judith; Schwarz, Thomas L. FHL2 anchors mitochondria to actin and adapts mitochondrial dynamics to glucose supply. The Journal Of Cell Biology. 2021;220(10) 

Norkett, Rosalind; Modi, Souvik; Birsa, Nicol; Atkin, Talia A; Ivankovic, Davor; Pathania, Manav; Trossbach, Svenja V; Korth, Carsten; Hirst, Warren D; Kittler, Josef T. DISC1-dependent Regulation of Mitochondrial Dynamics Controls the Morphogenesis of Complex Neuronal Dendrites. The Journal Of Biological Chemistry. 2016;291(2):613-29. 

Blue, R Eric; Koushik, Amrita; Engels, Nichlas M; Wiedner, Hannah J; Cooper, Thomas A; Giudice, Jimena. Modulation of alternative splicing of trafficking genes by genome editing reveals functional consequences in muscle biology. The International Journal Of Biochemistry & Cell Biology. 2018;105( 30316870):134-143. 

Zhao, Yinsuo; Song, Eli; Wang, Wenjuan; Hsieh, Chung-Han; Wang, Xinnan; Feng, Wei; Wang, Xiangming; Shen, Kang. Metaxins are core components of mitochondrial transport adaptor complexes. Nature Communications. 2021;12(1):83. 

Davis, Kayla; Basu, Himanish; Izquierdo-Villalba, Ismael; Shurberg, Ethan; Schwarz, Thomas L. Miro GTPase domains regulate the assembly of the mitochondrial motor-adaptor complex. Life Science Alliance. 2023;6(1) 

Dentoni, Giacomo; Naia, Luana; Portal, Benjamin; Leal, Nuno Santos; Nilsson, Per; Lindskog, Maria; Ankarcrona, Maria. Mitochondrial Alterations in Neurons Derived from the Murine AppNL-F Knock-In Model of Alzheimer's Disease. Journal Of Alzheimer's Disease : Jad. 90(2):565-583.