Anti TRAF3 pAb (ATL-HPA002933)

Atlas Antibodies

Catalog No.: ATL-HPA002933-25

Protein Description: TNF receptor-associated factor 3
Gene Name: TRAF3
Alternative Gene Name: CAP-1, CD40bp, CRAF1, LAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021277: 93%, ENSRNOG00000008145: 92%
Entrez Gene ID: 7187
Uniprot ID: Q13114
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV
• Gene Sequence: SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV
• Gene ID - Mouse: ENSMUSG00000021277
• Gene ID - Rat: ENSRNOG00000008145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRAF3 pAb (ATL-HPA002933) – 1 Found

Into, Takeshi; Niida, Shumpei; Shibata, Ken-Ichiro. MyD88 signaling causes autoimmune sialadenitis through formation of high endothelial venules and upregulation of LTβ receptor-mediated signaling. Scientific Reports. 2018;8(1):14272.