Anti TPT1 pAb (ATL-HPA039437)

Atlas Antibodies

Catalog No.:
ATL-HPA039437-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: tumor protein, translationally-controlled 1
Gene Name: TPT1
Alternative Gene Name: fortilin, TCTP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060126: 97%, ENSRNOG00000001049: 97%
Entrez Gene ID: 7178
Uniprot ID: P13693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYM
Gene Sequence MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYM
Gene ID - Mouse ENSMUSG00000060126
Gene ID - Rat ENSRNOG00000001049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPT1 pAb (ATL-HPA039437)
Datasheet Anti TPT1 pAb (ATL-HPA039437) Datasheet (External Link)
Vendor Page Anti TPT1 pAb (ATL-HPA039437) at Atlas Antibodies

Documents & Links for Anti TPT1 pAb (ATL-HPA039437)
Datasheet Anti TPT1 pAb (ATL-HPA039437) Datasheet (External Link)
Vendor Page Anti TPT1 pAb (ATL-HPA039437)