Anti TPSD1 pAb (ATL-HPA040182)

Atlas Antibodies

Catalog No.:
ATL-HPA040182-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tryptase delta 1
Gene Name: TPSD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024173: 64%, ENSRNOG00000024181: 62%
Entrez Gene ID: 23430
Uniprot ID: Q9BZJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRD
Gene Sequence NVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRD
Gene ID - Mouse ENSMUSG00000024173
Gene ID - Rat ENSRNOG00000024181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPSD1 pAb (ATL-HPA040182)
Datasheet Anti TPSD1 pAb (ATL-HPA040182) Datasheet (External Link)
Vendor Page Anti TPSD1 pAb (ATL-HPA040182) at Atlas Antibodies

Documents & Links for Anti TPSD1 pAb (ATL-HPA040182)
Datasheet Anti TPSD1 pAb (ATL-HPA040182) Datasheet (External Link)
Vendor Page Anti TPSD1 pAb (ATL-HPA040182)