Anti TPP2 pAb (ATL-HPA021069)

Atlas Antibodies

Catalog No.: ATL-HPA021069-25

Protein Description: tripeptidyl peptidase II
Gene Name: TPP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041763: 96%, ENSRNOG00000011194: 97%
Entrez Gene ID: 7174
Uniprot ID: P29144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLST
• Gene Sequence: SSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLST
• Gene ID - Mouse: ENSMUSG00000041763
• Gene ID - Rat: ENSRNOG00000011194
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TPP2 pAb (ATL-HPA021069) – 1 Found

Wiemhoefer, Anne; Stargardt, Anita; van der Linden, Wouter A; Renner, Maria C; van Kesteren, Ronald E; Stap, Jan; Raspe, Marcel A; Tomkinson, Birgitta; Kessels, Helmut W; Ovaa, Huib; Overkleeft, Herman S; Florea, Bogdan; Reits, Eric A. Tripeptidyl Peptidase II Mediates Levels of Nuclear Phosphorylated ERK1 and ERK2. Molecular & Cellular Proteomics : Mcp. 2015;14(8):2177-93.