Anti TPH1 pAb (ATL-HPA022483 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022483-25

Protein Description: tryptophan hydroxylase 1
Gene Name: TPH1
Alternative Gene Name: TPH, TPRH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040046: 85%, ENSRNOG00000011672: 86%
Entrez Gene ID: 7166
Uniprot ID: P17752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
• Gene Sequence: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
• Gene ID - Mouse: ENSMUSG00000040046
• Gene ID - Rat: ENSRNOG00000011672
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TPH1 pAb (ATL-HPA022483 w/enhanced validation) – 1 Found

Le Mestre, Julie; Duparc, Céline; Reznik, Yves; Bonnet-Serrano, Fidéline; Touraine, Philippe; Chabre, Olivier; Young, Jacques; Suzuki, Mari; Sibony, Mathilde; Gobet, Françoise; Stratakis, Constantine A; Raverot, Gérald; Bertherat, Jérôme; Lefebvre, Hervé; Louiset, Estelle. Illicit Upregulation of Serotonin Signaling Pathway in Adrenals of Patients With High Plasma or Intra-Adrenal ACTH Levels. The Journal Of Clinical Endocrinology And Metabolism. 2019;104(11):4967-4980.