Anti TP63 pAb (ATL-HPA007010 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007010-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: TP63
Alternative Gene Name: EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022510: 100%, ENSRNOG00000001924: 100%
Entrez Gene ID: 8626
Uniprot ID: Q9H3D4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYS |
| Gene Sequence | MMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYS |
| Gene ID - Mouse | ENSMUSG00000022510 |
| Gene ID - Rat | ENSRNOG00000001924 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) | |
| Datasheet | Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) | |
| Datasheet | Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) |