Anti TP63 pAb (ATL-HPA007010 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA007010-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: tumor protein p63
Gene Name: TP63
Alternative Gene Name: EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022510: 100%, ENSRNOG00000001924: 100%
Entrez Gene ID: 8626
Uniprot ID: Q9H3D4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYS
Gene Sequence MMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYS
Gene ID - Mouse ENSMUSG00000022510
Gene ID - Rat ENSRNOG00000001924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TP63 pAb (ATL-HPA007010 w/enhanced validation)
Datasheet Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TP63 pAb (ATL-HPA007010 w/enhanced validation)
Datasheet Anti TP63 pAb (ATL-HPA007010 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TP63 pAb (ATL-HPA007010 w/enhanced validation)