Anti TP53BP2 pAb (ATL-HPA021603)

Atlas Antibodies

Catalog No.:
ATL-HPA021603-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tumor protein p53 binding protein 2
Gene Name: TP53BP2
Alternative Gene Name: 53BP2, ASPP2, PPP1R13A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026510: 91%, ENSRNOG00000003237: 90%
Entrez Gene ID: 7159
Uniprot ID: Q13625
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERI
Gene Sequence PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERI
Gene ID - Mouse ENSMUSG00000026510
Gene ID - Rat ENSRNOG00000003237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TP53BP2 pAb (ATL-HPA021603)
Datasheet Anti TP53BP2 pAb (ATL-HPA021603) Datasheet (External Link)
Vendor Page Anti TP53BP2 pAb (ATL-HPA021603) at Atlas Antibodies

Documents & Links for Anti TP53BP2 pAb (ATL-HPA021603)
Datasheet Anti TP53BP2 pAb (ATL-HPA021603) Datasheet (External Link)
Vendor Page Anti TP53BP2 pAb (ATL-HPA021603)
Citations for Anti TP53BP2 pAb (ATL-HPA021603) – 2 Found
Royer, Christophe; Sandham, Elizabeth; Slee, Elizabeth; Schneider, Falk; Lagerholm, Christoffer B; Godwin, Jonathan; Veits, Nisha; Hathrell, Holly; Zhou, Felix; Leonavicius, Karolis; Garratt, Jemma; Narendra, Tanaya; Vincent, Anna; Jones, Celine; Child, Tim; Coward, Kevin; Graham, Chris; Fritzsche, Marco; Lu, Xin; Srinivas, Shankar. ASPP2 maintains the integrity of mechanically stressed pseudostratified epithelia during morphogenesis. Nature Communications. 2022;13(1):941.  PubMed
Liu, Dian; Ertay, Ayse; Hill, Charlotte; Zhou, Yilu; Li, Juanjuan; Zou, Yanmei; Qiu, Hong; Yuan, Xianglin; Ewing, Rob M; Lu, Xin; Xiong, Hua; Wang, Yihua. ASPP1 deficiency promotes epithelial-mesenchymal transition, invasion and metastasis in colorectal cancer. Cell Death & Disease. 2020;11(4):224.  PubMed