Anti TP53BP2 pAb (ATL-HPA021603)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021603-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TP53BP2
Alternative Gene Name: 53BP2, ASPP2, PPP1R13A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026510: 91%, ENSRNOG00000003237: 90%
Entrez Gene ID: 7159
Uniprot ID: Q13625
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERI |
| Gene Sequence | PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERI |
| Gene ID - Mouse | ENSMUSG00000026510 |
| Gene ID - Rat | ENSRNOG00000003237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TP53BP2 pAb (ATL-HPA021603) | |
| Datasheet | Anti TP53BP2 pAb (ATL-HPA021603) Datasheet (External Link) |
| Vendor Page | Anti TP53BP2 pAb (ATL-HPA021603) at Atlas Antibodies |
| Documents & Links for Anti TP53BP2 pAb (ATL-HPA021603) | |
| Datasheet | Anti TP53BP2 pAb (ATL-HPA021603) Datasheet (External Link) |
| Vendor Page | Anti TP53BP2 pAb (ATL-HPA021603) |
| Citations for Anti TP53BP2 pAb (ATL-HPA021603) – 2 Found |
| Royer, Christophe; Sandham, Elizabeth; Slee, Elizabeth; Schneider, Falk; Lagerholm, Christoffer B; Godwin, Jonathan; Veits, Nisha; Hathrell, Holly; Zhou, Felix; Leonavicius, Karolis; Garratt, Jemma; Narendra, Tanaya; Vincent, Anna; Jones, Celine; Child, Tim; Coward, Kevin; Graham, Chris; Fritzsche, Marco; Lu, Xin; Srinivas, Shankar. ASPP2 maintains the integrity of mechanically stressed pseudostratified epithelia during morphogenesis. Nature Communications. 2022;13(1):941. PubMed |
| Liu, Dian; Ertay, Ayse; Hill, Charlotte; Zhou, Yilu; Li, Juanjuan; Zou, Yanmei; Qiu, Hong; Yuan, Xianglin; Ewing, Rob M; Lu, Xin; Xiong, Hua; Wang, Yihua. ASPP1 deficiency promotes epithelial-mesenchymal transition, invasion and metastasis in colorectal cancer. Cell Death & Disease. 2020;11(4):224. PubMed |