Anti TP53AIP1 pAb (ATL-HPA044300)

Atlas Antibodies

Catalog No.: ATL-HPA044300-25

Protein Description: tumor protein p53 regulated apoptosis inducing protein 1
Gene Name: TP53AIP1
Alternative Gene Name: p53AIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003135: 32%, ENSRNOG00000018191: 35%
Entrez Gene ID: 63970
Uniprot ID: Q9HCN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGC
• Gene Sequence: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGC
• Gene ID - Mouse: ENSMUSG00000003135
• Gene ID - Rat: ENSRNOG00000018191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.