Anti TOX4 pAb (ATL-HPA017880)

Atlas Antibodies

Catalog No.: ATL-HPA017880-25

Protein Description: TOX high mobility group box family member 4
Gene Name: TOX4
Alternative Gene Name: C14orf92, KIAA0737, LCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016831: 93%, ENSRNOG00000012844: 90%
Entrez Gene ID: 9878
Uniprot ID: O94842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MQQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVAS
• Gene Sequence: MQQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVAS
• Gene ID - Mouse: ENSMUSG00000016831
• Gene ID - Rat: ENSRNOG00000012844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TOX4 pAb (ATL-HPA017880) – 3 Found

Morchikh, Mehdi; Naughtin, Monica; Di Nunzio, Francesca; Xavier, Johan; Charneau, Pierre; Jacob, Yves; Lavigne, Marc. TOX4 and NOVA1 proteins are partners of the LEDGF PWWP domain and affect HIV-1 replication. Plos One. 8(11):e81217. 

Ding, Li; Paszkowski-Rogacz, Maciej; Winzi, Maria; Chakraborty, Debojyoti; Theis, Mirko; Singh, Sukhdeep; Ciotta, Giovanni; Poser, Ina; Roguev, Assen; Chu, Wai Kit; Choudhary, Chunaram; Mann, Matthias; Stewart, A Francis; Krogan, Nevan; Buchholz, Frank. Systems Analyses Reveal Shared and Diverse Attributes of Oct4 Regulation in Pluripotent Cells. Cell Systems. 2015;1(2):141-51. 

Vanheer, Lotte; Song, Juan; De Geest, Natalie; Janiszewski, Adrian; Talon, Irene; Provenzano, Caterina; Oh, Taeho; Chappell, Joel; Pasque, Vincent. Tox4 modulates cell fate reprogramming. Journal Of Cell Science. 2019;132(20)