Anti TOR3A pAb (ATL-HPA028766)

Atlas Antibodies

Catalog No.: ATL-HPA028766-25

Protein Description: torsin family 3, member A
Gene Name: TOR3A
Alternative Gene Name: ADIR, ADIR2, FLJ22345
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060519: 73%, ENSRNOG00000004307: 74%
Entrez Gene ID: 64222
Uniprot ID: Q9H497
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDA
• Gene Sequence: NLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDA
• Gene ID - Mouse: ENSMUSG00000060519
• Gene ID - Rat: ENSRNOG00000004307
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.