Anti TOMM6 pAb (ATL-HPA004801 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004801-25

Protein Description: translocase of outer mitochondrial membrane 6 homolog (yeast)
Gene Name: TOMM6
Alternative Gene Name: OBTP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033475: 90%, ENSRNOG00000046316: 92%
Entrez Gene ID: 100188893
Uniprot ID: Q96B49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQ
• Gene Sequence: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQ
• Gene ID - Mouse: ENSMUSG00000033475
• Gene ID - Rat: ENSRNOG00000046316
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.