Anti TOMM22 pAb (ATL-HPA003037 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003037-25

Protein Description: translocase of outer mitochondrial membrane 22 homolog (yeast)
Gene Name: TOMM22
Alternative Gene Name: TOM22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022427: 92%, ENSRNOG00000014058: 89%
Entrez Gene ID: 56993
Uniprot ID: Q9NS69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
• Gene Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
• Gene ID - Mouse: ENSMUSG00000022427
• Gene ID - Rat: ENSRNOG00000014058
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TOMM22 pAb (ATL-HPA003037 w/enhanced validation) – 5 Found

Mollá, Belén; Riveiro, Fátima; Bolinches-Amorós, Arantxa; Muñoz-Lasso, Diana C; Palau, Francesc; González-Cabo, Pilar. Two different pathogenic mechanisms, dying-back axonal neuropathy and pancreatic senescence, are present in the YG8R mouse model of Friedreich's ataxia. Disease Models & Mechanisms. 2016;9(6):647-57. 

Dennerlein, Sven; Poerschke, Sabine; Oeljeklaus, Silke; Wang, Cong; Richter-Dennerlein, Ricarda; Sattmann, Johannes; Bauermeister, Diana; Hanitsch, Elisa; Stoldt, Stefan; Langer, Thomas; Jakobs, Stefan; Warscheid, Bettina; Rehling, Peter. Defining the interactome of the human mitochondrial ribosome identifies SMIM4 and TMEM223 as respiratory chain assembly factors. Elife. 2021;10( 34969438) 

Latil, Mathilde; Rocheteau, Pierre; Châtre, Laurent; Sanulli, Serena; Mémet, Sylvie; Ricchetti, Miria; Tajbakhsh, Shahragim; Chrétien, Fabrice. Skeletal muscle stem cells adopt a dormant cell state post mortem and retain regenerative capacity. Nature Communications. 2012;3( 22692546):903. 

Guantes, Raul; Rastrojo, Alberto; Neves, Ricardo; Lima, Ana; Aguado, Begoña; Iborra, Francisco J. Global variability in gene expression and alternative splicing is modulated by mitochondrial content. Genome Research. 2015;25(5):633-44. 

Elouej, Sahar; Harhouri, Karim; Le Mao, Morgane; Baujat, Genevieve; Nampoothiri, Sheela; Kayserili, Hϋlya; Menabawy, Nihal Al; Selim, Laila; Paneque, Arianne Llamos; Kubisch, Christian; Lessel, Davor; Rubinsztajn, Robert; Charar, Chayki; Bartoli, Catherine; Airault, Coraline; Deleuze, Jean-François; Rötig, Agnes; Bauer, Peter; Pereira, Catarina; Loh, Abigail; Escande-Beillard, Nathalie; Muchir, Antoine; Martino, Lisa; Gruenbaum, Yosef; Lee, Song-Hua; Manivet, Philippe; Lenaers, Guy; Reversade, Bruno; Lévy, Nicolas; De Sandre-Giovannoli, Annachiara. Loss of MTX2 causes mandibuloacral dysplasia and links mitochondrial dysfunction to altered nuclear morphology. Nature Communications. 2020;11(1):4589.