Anti TNS2 pAb (ATL-HPA034659)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034659-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TNS2
Alternative Gene Name: C1-TEN, KIAA1075, TENC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037003: 69%, ENSRNOG00000010588: 68%
Entrez Gene ID: 23371
Uniprot ID: Q63HR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN |
| Gene Sequence | VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN |
| Gene ID - Mouse | ENSMUSG00000037003 |
| Gene ID - Rat | ENSRNOG00000010588 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TNS2 pAb (ATL-HPA034659) | |
| Datasheet | Anti TNS2 pAb (ATL-HPA034659) Datasheet (External Link) |
| Vendor Page | Anti TNS2 pAb (ATL-HPA034659) at Atlas Antibodies |
| Documents & Links for Anti TNS2 pAb (ATL-HPA034659) | |
| Datasheet | Anti TNS2 pAb (ATL-HPA034659) Datasheet (External Link) |
| Vendor Page | Anti TNS2 pAb (ATL-HPA034659) |
| Citations for Anti TNS2 pAb (ATL-HPA034659) – 4 Found |
| Lee, Jiyoun; Koh, Ara; Jeong, Heeyoon; Kim, Eui; Ha, Tae-Sun; Saleem, Moin A; Ryu, Sung Ho. C1-Ten is a PTPase of nephrin, regulating podocyte hypertrophy through mTORC1 activation. Scientific Reports. 2017;7(1):12346. PubMed |
| Ashraf, Shazia; Kudo, Hiroki; Rao, Jia; Kikuchi, Atsuo; Widmeier, Eugen; Lawson, Jennifer A; Tan, Weizhen; Hermle, Tobias; Warejko, Jillian K; Shril, Shirlee; Airik, Merlin; Jobst-Schwan, Tilman; Lovric, Svjetlana; Braun, Daniela A; Gee, Heon Yung; Schapiro, David; Majmundar, Amar J; Sadowski, Carolin E; Pabst, Werner L; Daga, Ankana; van der Ven, Amelie T; Schmidt, Johanna M; Low, Boon Chuan; Gupta, Anjali Bansal; Tripathi, Brajendra K; Wong, Jenny; Campbell, Kirk; Metcalfe, Kay; Schanze, Denny; Niihori, Tetsuya; Kaito, Hiroshi; Nozu, Kandai; Tsukaguchi, Hiroyasu; Tanaka, Ryojiro; Hamahira, Kiyoshi; Kobayashi, Yasuko; Takizawa, Takumi; Funayama, Ryo; Nakayama, Keiko; Aoki, Yoko; Kumagai, Naonori; Iijima, Kazumoto; Fehrenbach, Henry; Kari, Jameela A; El Desoky, Sherif; Jalalah, Sawsan; Bogdanovic, Radovan; Stajić, Nataša; Zappel, Hildegard; Rakhmetova, Assel; Wassmer, Sharon-Rose; Jungraithmayr, Therese; Strehlau, Juergen; Kumar, Aravind Selvin; Bagga, Arvind; Soliman, Neveen A; Mane, Shrikant M; Kaufman, Lewis; Lowy, Douglas R; Jairajpuri, Mohamad A; Lifton, Richard P; Pei, York; Zenker, Martin; Kure, Shigeo; Hildebrandt, Friedhelm. Mutations in six nephrosis genes delineate a pathogenic pathway amenable to treatment. Nature Communications. 2018;9(1):1960. PubMed |
| Dieterich, Lothar C; Mellberg, Sofie; Langenkamp, Elise; Zhang, Lei; Zieba, Agata; Salomäki, Henriikka; Teichert, Martin; Huang, Hua; Edqvist, Per-Henrik; Kraus, Theo; Augustin, Hellmut G; Olofsson, Tommie; Larsson, Erik; Söderberg, Ola; Molema, Grietje; Pontén, Fredrik; Georgii-Hemming, Patrik; Alafuzoff, Irina; Dimberg, Anna. Transcriptional profiling of human glioblastoma vessels indicates a key role of VEGF-A and TGFβ2 in vascular abnormalization. The Journal Of Pathology. 2012;228(3):378-90. PubMed |
| Nizioł, Marcin; Zińczuk, Justyna; Zaręba, Konrad; Guzińska-Ustymowicz, Katarzyna; Pryczynicz, Anna. Immunohistochemical Analysis of the Expression of Adhesion Proteins: TNS1, TNS2 and TNS3 in Correlation with Clinicopathological Parameters in Gastric Cancer. Biomolecules. 2021;11(5) PubMed |