Anti TNRC6B pAb (ATL-HPA003180)

Atlas Antibodies

Catalog No.:
ATL-HPA003180-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: trinucleotide repeat containing 6B
Gene Name: TNRC6B
Alternative Gene Name: KIAA1093
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047888: 95%, ENSRNOG00000024907: 89%
Entrez Gene ID: 23112
Uniprot ID: Q9UPQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWTS
Gene Sequence QIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWTS
Gene ID - Mouse ENSMUSG00000047888
Gene ID - Rat ENSRNOG00000024907
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNRC6B pAb (ATL-HPA003180)
Datasheet Anti TNRC6B pAb (ATL-HPA003180) Datasheet (External Link)
Vendor Page Anti TNRC6B pAb (ATL-HPA003180) at Atlas Antibodies

Documents & Links for Anti TNRC6B pAb (ATL-HPA003180)
Datasheet Anti TNRC6B pAb (ATL-HPA003180) Datasheet (External Link)
Vendor Page Anti TNRC6B pAb (ATL-HPA003180)
Citations for Anti TNRC6B pAb (ATL-HPA003180) – 1 Found
Murakami, Yoshiki; Tamori, Akihiro; Itami, Saori; Tanahashi, Toshihito; Toyoda, Hidenori; Tanaka, Masami; Wu, Weihong; Brojigin, Nariso; Kaneoka, Yuji; Maeda, Atsuyuki; Kumada, Takashi; Kawada, Norifumi; Kubo, Shoji; Kuroda, Masahiko. The expression level of miR-18b in hepatocellular carcinoma is associated with the grade of malignancy and prognosis. Bmc Cancer. 2013;13( 23496901):99.  PubMed