Anti TNP1 pAb (ATL-HPA044387 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044387-25

Protein Description: transition protein 1 (during histone to protamine replacement)
Gene Name: TNP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026182: 87%, ENSRNOG00000017611: 87%
Entrez Gene ID: 7141
Uniprot ID: P09430
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
• Gene Sequence: STSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
• Gene ID - Mouse: ENSMUSG00000026182
• Gene ID - Rat: ENSRNOG00000017611
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNP1 pAb (ATL-HPA044387 w/enhanced validation) – 2 Found

de Michele, Francesca; Poels, Jonathan; Vermeulen, Maxime; Ambroise, Jérôme; Gruson, Damien; Guiot, Yves; Wyns, Christine. Haploid Germ Cells Generated in Organotypic Culture of Testicular Tissue From Prepubertal Boys. Frontiers In Physiology. 9( 30356879):1413. 

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.