Anti TNNT2 pAb (ATL-HPA017888 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017888-25

Protein Description: troponin T type 2 (cardiac)
Gene Name: TNNT2
Alternative Gene Name: CMD1D, CMH2, CMPD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026414: 63%, ENSRNOG00000033734: 60%
Entrez Gene ID: 7139
Uniprot ID: P45379
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEEVVEEYEEEEQEEAAVEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLV
• Gene Sequence: IEEVVEEYEEEEQEEAAVEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLV
• Gene ID - Mouse: ENSMUSG00000026414
• Gene ID - Rat: ENSRNOG00000033734
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNNT2 pAb (ATL-HPA017888 w/enhanced validation) – 3 Found

Sridharan, Divya; Palaniappan, Arunkumar; Blackstone, Britani N; Dougherty, Julie A; Kumar, Naresh; Seshagiri, Polani B; Sayed, Nazish; Powell, Heather M; Khan, Mahmood. In situ differentiation of human-induced pluripotent stem cells into functional cardiomyocytes on a coaxial PCL-gelatin nanofibrous scaffold. Materials Science & Engineering. C, Materials For Biological Applications. 2021;118( 33254974):111354. 

Kumar, Naresh; Sridharan, Divya; Palaniappan, Arunkumar; Dougherty, Julie A; Czirok, Andras; Isai, Dona Greta; Mergaye, Muhamad; Angelos, Mark G; Powell, Heather M; Khan, Mahmood. Scalable Biomimetic Coaxial Aligned Nanofiber Cardiac Patch: A Potential Model for "Clinical Trials in a Dish". Frontiers In Bioengineering And Biotechnology. 8( 33042968):567842. 

Saha, Saswati; Spinelli, Lionel; Castro Mondragon, Jaime A; Kervadec, Anaïs; Lynott, Michaela; Kremmer, Laurent; Roder, Laurence; Krifa, Sallouha; Torres, Magali; Brun, Christine; Vogler, Georg; Bodmer, Rolf; Colas, Alexandre R; Ocorr, Karen; Perrin, Laurent. Genetic architecture of natural variation of cardiac performance from flies to humans. Elife. 2022;11( 36383075)