Anti TNMD pAb (ATL-HPA034961)

Atlas Antibodies

Catalog No.: ATL-HPA034961-25

Protein Description: tenomodulin
Gene Name: TNMD
Alternative Gene Name: BRICD4, ChM1L, myodulin, TEM, tendin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031250: 100%, ENSRNOG00000060970: 100%
Entrez Gene ID: 64102
Uniprot ID: Q9H2S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRV
• Gene Sequence: GIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRV
• Gene ID - Mouse: ENSMUSG00000031250
• Gene ID - Rat: ENSRNOG00000060970
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNMD pAb (ATL-HPA034961) – 1 Found

Lin, Dasheng; Alberton, Paolo; Delgado Caceres, Manuel; Prein, Carina; Clausen-Schaumann, Hauke; Dong, Jian; Aszodi, Attila; Shukunami, Chisa; Iatridis, James C; Docheva, Denitsa. Loss of tenomodulin expression is a risk factor for age-related intervertebral disc degeneration. Aging Cell. 2020;19(3):e13091.