Anti TNFRSF1A pAb (ATL-HPA004102)

Atlas Antibodies

Catalog No.: ATL-HPA004102-25

Protein Description: tumor necrosis factor receptor superfamily, member 1A
Gene Name: TNFRSF1A
Alternative Gene Name: CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030341: 72%, ENSRNOG00000031312: 70%
Entrez Gene ID: 7132
Uniprot ID: P19438
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC
• Gene Sequence: GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC
• Gene ID - Mouse: ENSMUSG00000030341
• Gene ID - Rat: ENSRNOG00000031312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNFRSF1A pAb (ATL-HPA004102) – 1 Found

Yang, Biao; Pan, Yuan-Bo; Ma, Yan-Bin; Chu, Sheng-Hua. Integrated Transcriptome Analyses and Experimental Verifications of Mesenchymal-Associated TNFRSF1A as a Diagnostic and Prognostic Biomarker in Gliomas. Frontiers In Oncology. 10( 32257943):250.