Anti TMX2 pAb (ATL-HPA040282)

Atlas Antibodies

Catalog No.:
ATL-HPA040282-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: thioredoxin-related transmembrane protein 2
Gene Name: TMX2
Alternative Gene Name: PDIA12, TXNDC14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050043: 99%, ENSRNOG00000005308: 99%
Entrez Gene ID: 51075
Uniprot ID: Q9Y320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP
Gene Sequence YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP
Gene ID - Mouse ENSMUSG00000050043
Gene ID - Rat ENSRNOG00000005308
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMX2 pAb (ATL-HPA040282)
Datasheet Anti TMX2 pAb (ATL-HPA040282) Datasheet (External Link)
Vendor Page Anti TMX2 pAb (ATL-HPA040282) at Atlas Antibodies

Documents & Links for Anti TMX2 pAb (ATL-HPA040282)
Datasheet Anti TMX2 pAb (ATL-HPA040282) Datasheet (External Link)
Vendor Page Anti TMX2 pAb (ATL-HPA040282)
Citations for Anti TMX2 pAb (ATL-HPA040282) – 2 Found
Soni, Siddarth; Raaijmakers, Antonia J A; Raaijmakers, Linsey M; Damen, J Mirjam A; van Stuijvenberg, Leonie; Vos, Marc A; Heck, Albert J R; van Veen, Toon A B; Scholten, Arjen. A Proteomics Approach to Identify New Putative Cardiac Intercalated Disk Proteins. Plos One. 11(5):e0152231.  PubMed
Vandervore, Laura V; Schot, Rachel; Milanese, Chiara; Smits, Daphne J; Kasteleijn, Esmee; Fry, Andrew E; Pilz, Daniela T; Brock, Stefanie; Börklü-Yücel, Esra; Post, Marco; Bahi-Buisson, Nadia; Sánchez-Soler, María José; van Slegtenhorst, Marjon; Keren, Boris; Afenjar, Alexandra; Coury, Stephanie A; Tan, Wen-Hann; Oegema, Renske; de Vries, Linda S; Fawcett, Katherine A; Nikkels, Peter G J; Bertoli-Avella, Aida; Al Hashem, Amal; Alwabel, Abdulmalik A; Tlili-Graiess, Kalthoum; Efthymiou, Stephanie; Zafar, Faisal; Rana, Nuzhat; Bibi, Farah; Houlden, Henry; Maroofian, Reza; Person, Richard E; Crunk, Amy; Savatt, Juliann M; Turner, Lisbeth; Doosti, Mohammad; Karimiani, Ehsan Ghayoor; Saadi, Nebal Waill; Akhondian, Javad; Lequin, Maarten H; Kayserili, Hülya; van der Spek, Peter J; Jansen, Anna C; Kros, Johan M; Verdijk, Robert M; Milošević, Nataša Jovanov; Fornerod, Maarten; Mastroberardino, Pier Giorgio; Mancini, Grazia M S. TMX2 Is a Crucial Regulator of Cellular Redox State, and Its Dysfunction Causes Severe Brain Developmental Abnormalities. American Journal Of Human Genetics. 2019;105(6):1126-1147.  PubMed