Anti TMUB2 pAb (ATL-HPA043137)

Atlas Antibodies

Catalog No.: ATL-HPA043137-25

Protein Description: transmembrane and ubiquitin-like domain containing 2
Gene Name: TMUB2
Alternative Gene Name: MGC3123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034757: 86%, ENSRNOG00000020916: 86%
Entrez Gene ID: 79089
Uniprot ID: Q71RG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKL
• Gene Sequence: LEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKL
• Gene ID - Mouse: ENSMUSG00000034757
• Gene ID - Rat: ENSRNOG00000020916
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.