Anti TMTC3 pAb (ATL-HPA038550)

Atlas Antibodies

Catalog No.: ATL-HPA038550-25

Protein Description: transmembrane and tetratricopeptide repeat containing 3
Gene Name: TMTC3
Alternative Gene Name: FLJ90492, SMILE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036676: 98%, ENSRNOG00000006749: 95%
Entrez Gene ID: 160418
Uniprot ID: Q6ZXV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGE
• Gene Sequence: RQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGE
• Gene ID - Mouse: ENSMUSG00000036676
• Gene ID - Rat: ENSRNOG00000006749
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.