Anti TMPRSS7 pAb (ATL-HPA040630)

Atlas Antibodies

Catalog No.:
ATL-HPA040630-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protease, serine 7
Gene Name: TMPRSS7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033177: 84%, ENSRNOG00000002145: 84%
Entrez Gene ID: 344805
Uniprot ID: Q7RTY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCD
Gene Sequence DESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCD
Gene ID - Mouse ENSMUSG00000033177
Gene ID - Rat ENSRNOG00000002145
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMPRSS7 pAb (ATL-HPA040630)
Datasheet Anti TMPRSS7 pAb (ATL-HPA040630) Datasheet (External Link)
Vendor Page Anti TMPRSS7 pAb (ATL-HPA040630) at Atlas Antibodies

Documents & Links for Anti TMPRSS7 pAb (ATL-HPA040630)
Datasheet Anti TMPRSS7 pAb (ATL-HPA040630) Datasheet (External Link)
Vendor Page Anti TMPRSS7 pAb (ATL-HPA040630)