Anti TMOD3 pAb (ATL-HPA001849 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001849-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TMOD3
Alternative Gene Name: UTMOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058587: 88%, ENSRNOG00000032436: 90%
Entrez Gene ID: 29766
Uniprot ID: Q9NYL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD |
| Gene Sequence | LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD |
| Gene ID - Mouse | ENSMUSG00000058587 |
| Gene ID - Rat | ENSRNOG00000032436 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMOD3 pAb (ATL-HPA001849 w/enhanced validation) | |
| Datasheet | Anti TMOD3 pAb (ATL-HPA001849 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMOD3 pAb (ATL-HPA001849 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TMOD3 pAb (ATL-HPA001849 w/enhanced validation) | |
| Datasheet | Anti TMOD3 pAb (ATL-HPA001849 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMOD3 pAb (ATL-HPA001849 w/enhanced validation) |
| Citations for Anti TMOD3 pAb (ATL-HPA001849 w/enhanced validation) – 2 Found |
| Singleton, D C; Rouhi, P; Zois, C E; Haider, S; Li, J-L; Kessler, B M; Cao, Y; Harris, A L. Hypoxic regulation of RIOK3 is a major mechanism for cancer cell invasion and metastasis. Oncogene. 2015;34(36):4713-22. PubMed |
| Marei, Hadir; Carpy, Alejandro; Macek, Boris; Malliri, Angeliki. Proteomic analysis of Rac1 signaling regulation by guanine nucleotide exchange factors. Cell Cycle (Georgetown, Tex.). 2016;15(15):1961-74. PubMed |