Anti TMOD2 pAb (ATL-HPA041365 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041365-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/91423/166677/atl-hpa041365_anti-tmod2-pab-atl-hpa041365-wenhanced-validation_48321__50144.1681119564.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMOD2
Alternative Gene Name: NTMOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032186: 91%, ENSRNOG00000010447: 91%
Entrez Gene ID: 29767
Uniprot ID: Q9NZR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPN |
| Gene Sequence | TELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPN |
| Gene ID - Mouse | ENSMUSG00000032186 |
| Gene ID - Rat | ENSRNOG00000010447 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMOD2 pAb (ATL-HPA041365 w/enhanced validation) | |
| Datasheet | Anti TMOD2 pAb (ATL-HPA041365 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMOD2 pAb (ATL-HPA041365 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TMOD2 pAb (ATL-HPA041365 w/enhanced validation) | |
| Datasheet | Anti TMOD2 pAb (ATL-HPA041365 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMOD2 pAb (ATL-HPA041365 w/enhanced validation) |
| Citations for Anti TMOD2 pAb (ATL-HPA041365 w/enhanced validation) – 1 Found |
| Kumari, Reena; Jiu, Yaming; Carman, Peter J; Tojkander, Sari; Kogan, Konstantin; Varjosalo, Markku; Gunning, Peter W; Dominguez, Roberto; Lappalainen, Pekka. Tropomodulins Control the Balance between Protrusive and Contractile Structures by Stabilizing Actin-Tropomyosin Filaments. Current Biology : Cb. 2020;30(5):767-778.e5. PubMed |