Anti TMIE pAb (ATL-HPA038298)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038298-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMIE
Alternative Gene Name: DFNB6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049555: 98%, ENSRNOG00000027799: 98%
Entrez Gene ID: 259236
Uniprot ID: Q8NEW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKK |
| Gene Sequence | RTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKK |
| Gene ID - Mouse | ENSMUSG00000049555 |
| Gene ID - Rat | ENSRNOG00000027799 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMIE pAb (ATL-HPA038298) | |
| Datasheet | Anti TMIE pAb (ATL-HPA038298) Datasheet (External Link) |
| Vendor Page | Anti TMIE pAb (ATL-HPA038298) at Atlas Antibodies |
| Documents & Links for Anti TMIE pAb (ATL-HPA038298) | |
| Datasheet | Anti TMIE pAb (ATL-HPA038298) Datasheet (External Link) |
| Vendor Page | Anti TMIE pAb (ATL-HPA038298) |