Anti TMIE pAb (ATL-HPA038298)

Atlas Antibodies

Catalog No.:
ATL-HPA038298-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane inner ear
Gene Name: TMIE
Alternative Gene Name: DFNB6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049555: 98%, ENSRNOG00000027799: 98%
Entrez Gene ID: 259236
Uniprot ID: Q8NEW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKK
Gene Sequence RTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKK
Gene ID - Mouse ENSMUSG00000049555
Gene ID - Rat ENSRNOG00000027799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMIE pAb (ATL-HPA038298)
Datasheet Anti TMIE pAb (ATL-HPA038298) Datasheet (External Link)
Vendor Page Anti TMIE pAb (ATL-HPA038298) at Atlas Antibodies

Documents & Links for Anti TMIE pAb (ATL-HPA038298)
Datasheet Anti TMIE pAb (ATL-HPA038298) Datasheet (External Link)
Vendor Page Anti TMIE pAb (ATL-HPA038298)