Anti TMEM9B pAb (ATL-HPA037784)

Atlas Antibodies

Catalog No.: ATL-HPA037784-25

Protein Description: TMEM9 domain family, member B
Gene Name: TMEM9B
Alternative Gene Name: C11orf15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031021: 94%, ENSRNOG00000013591: 96%
Entrez Gene ID: 56674
Uniprot ID: Q9NQ34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQ
• Gene Sequence: EPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQ
• Gene ID - Mouse: ENSMUSG00000031021
• Gene ID - Rat: ENSRNOG00000013591
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.