Anti TMEM9 pAb (ATL-HPA008483)

Atlas Antibodies

Catalog No.:
ATL-HPA008483-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 9
Gene Name: TMEM9
Alternative Gene Name: TMEM9A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026411: 100%, ENSRNOG00000010204: 100%
Entrez Gene ID: 252839
Uniprot ID: Q9P0T7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVEPMPVPGHDVEAY
Gene Sequence NKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVEPMPVPGHDVEAY
Gene ID - Mouse ENSMUSG00000026411
Gene ID - Rat ENSRNOG00000010204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM9 pAb (ATL-HPA008483)
Datasheet Anti TMEM9 pAb (ATL-HPA008483) Datasheet (External Link)
Vendor Page Anti TMEM9 pAb (ATL-HPA008483) at Atlas Antibodies

Documents & Links for Anti TMEM9 pAb (ATL-HPA008483)
Datasheet Anti TMEM9 pAb (ATL-HPA008483) Datasheet (External Link)
Vendor Page Anti TMEM9 pAb (ATL-HPA008483)