Anti TMEM9 pAb (ATL-HPA008483)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008483-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMEM9
Alternative Gene Name: TMEM9A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026411: 100%, ENSRNOG00000010204: 100%
Entrez Gene ID: 252839
Uniprot ID: Q9P0T7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVEPMPVPGHDVEAY |
| Gene Sequence | NKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVEPMPVPGHDVEAY |
| Gene ID - Mouse | ENSMUSG00000026411 |
| Gene ID - Rat | ENSRNOG00000010204 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM9 pAb (ATL-HPA008483) | |
| Datasheet | Anti TMEM9 pAb (ATL-HPA008483) Datasheet (External Link) |
| Vendor Page | Anti TMEM9 pAb (ATL-HPA008483) at Atlas Antibodies |
| Documents & Links for Anti TMEM9 pAb (ATL-HPA008483) | |
| Datasheet | Anti TMEM9 pAb (ATL-HPA008483) Datasheet (External Link) |
| Vendor Page | Anti TMEM9 pAb (ATL-HPA008483) |