Anti TMEM78 pAb (ATL-HPA042351)

Atlas Antibodies

Catalog No.:
ATL-HPA042351-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 78
Gene Name: TMEM78
Alternative Gene Name: FLJ40168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030126: 30%, ENSRNOG00000042182: 29%
Entrez Gene ID:
Uniprot ID: Q5T7P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNLGIVISCWKGVCVPQTTTLEMFYNDNDRVEESSNSYQIRRE
Gene Sequence RNLGIVISCWKGVCVPQTTTLEMFYNDNDRVEESSNSYQIRRE
Gene ID - Mouse ENSMUSG00000030126
Gene ID - Rat ENSRNOG00000042182
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM78 pAb (ATL-HPA042351)
Datasheet Anti TMEM78 pAb (ATL-HPA042351) Datasheet (External Link)
Vendor Page Anti TMEM78 pAb (ATL-HPA042351) at Atlas Antibodies

Documents & Links for Anti TMEM78 pAb (ATL-HPA042351)
Datasheet Anti TMEM78 pAb (ATL-HPA042351) Datasheet (External Link)
Vendor Page Anti TMEM78 pAb (ATL-HPA042351)