Anti TMEM55A pAb (ATL-HPA014591)

Atlas Antibodies

Catalog No.:
ATL-HPA014591-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 55A
Gene Name: TMEM55A
Alternative Gene Name: DKFZp762O076
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028221: 100%, ENSRNOG00000006697: 98%
Entrez Gene ID: 55529
Uniprot ID: Q8N4L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSA
Gene Sequence PCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSA
Gene ID - Mouse ENSMUSG00000028221
Gene ID - Rat ENSRNOG00000006697
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM55A pAb (ATL-HPA014591)
Datasheet Anti TMEM55A pAb (ATL-HPA014591) Datasheet (External Link)
Vendor Page Anti TMEM55A pAb (ATL-HPA014591) at Atlas Antibodies

Documents & Links for Anti TMEM55A pAb (ATL-HPA014591)
Datasheet Anti TMEM55A pAb (ATL-HPA014591) Datasheet (External Link)
Vendor Page Anti TMEM55A pAb (ATL-HPA014591)