Anti TMEM44 pAb (ATL-HPA043718)

Atlas Antibodies

Catalog No.:
ATL-HPA043718-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 44
Gene Name: TMEM44
Alternative Gene Name: DKFZp686O18124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022537: 82%, ENSRNOG00000001726: 76%
Entrez Gene ID: 93109
Uniprot ID: Q2T9K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTQALLTCAEKEEENQENLDWVPLTTLSHCKSLRTMTAISRYMELTIEPVQQAGCSATRLPGDGQTSAGDASLQDPPSYPPVQVIRA
Gene Sequence DTQALLTCAEKEEENQENLDWVPLTTLSHCKSLRTMTAISRYMELTIEPVQQAGCSATRLPGDGQTSAGDASLQDPPSYPPVQVIRA
Gene ID - Mouse ENSMUSG00000022537
Gene ID - Rat ENSRNOG00000001726
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM44 pAb (ATL-HPA043718)
Datasheet Anti TMEM44 pAb (ATL-HPA043718) Datasheet (External Link)
Vendor Page Anti TMEM44 pAb (ATL-HPA043718) at Atlas Antibodies

Documents & Links for Anti TMEM44 pAb (ATL-HPA043718)
Datasheet Anti TMEM44 pAb (ATL-HPA043718) Datasheet (External Link)
Vendor Page Anti TMEM44 pAb (ATL-HPA043718)