Anti TMEM30B pAb (ATL-HPA043162)

Atlas Antibodies

Catalog No.:
ATL-HPA043162-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 30B
Gene Name: TMEM30B
Alternative Gene Name: CDC50B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034435: 85%, ENSRNOG00000008046: 84%
Entrez Gene ID: 161291
Uniprot ID: Q3MIR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIKELEYDYTGDPGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNEC
Gene Sequence GIKELEYDYTGDPGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNEC
Gene ID - Mouse ENSMUSG00000034435
Gene ID - Rat ENSRNOG00000008046
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM30B pAb (ATL-HPA043162)
Datasheet Anti TMEM30B pAb (ATL-HPA043162) Datasheet (External Link)
Vendor Page Anti TMEM30B pAb (ATL-HPA043162) at Atlas Antibodies

Documents & Links for Anti TMEM30B pAb (ATL-HPA043162)
Datasheet Anti TMEM30B pAb (ATL-HPA043162) Datasheet (External Link)
Vendor Page Anti TMEM30B pAb (ATL-HPA043162)