Anti TMEM260 pAb (ATL-HPA003502)

Atlas Antibodies

Catalog No.: ATL-HPA003502-25

Protein Description: transmembrane protein 260
Gene Name: TMEM260
Alternative Gene Name: C14orf101, FLJ20392
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036339: 81%, ENSRNOG00000013353: 80%
Entrez Gene ID: 54916
Uniprot ID: Q9NX78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSYLNHARWTWGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSFNIQALAVCANICLATKDRQNP
• Gene Sequence: SSYLNHARWTWGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSFNIQALAVCANICLATKDRQNP
• Gene ID - Mouse: ENSMUSG00000036339
• Gene ID - Rat: ENSRNOG00000013353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.