Anti TMEM259 pAb (ATL-HPA042669)

Atlas Antibodies

Catalog No.: ATL-HPA042669-25

Protein Description: transmembrane protein 259
Gene Name: TMEM259
Alternative Gene Name: ASBABP1, C19orf6, MBRL, MGC4022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013858: 92%, ENSRNOG00000012808: 90%
Entrez Gene ID: 91304
Uniprot ID: Q4ZIN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKFELDIEPKVFKPPSSTEALNDSQEFPFPETPTKVWPQDEYIVEYSLEYGFLRLSQATRQRLSIPVMVVTL
• Gene Sequence: IKFELDIEPKVFKPPSSTEALNDSQEFPFPETPTKVWPQDEYIVEYSLEYGFLRLSQATRQRLSIPVMVVTL
• Gene ID - Mouse: ENSMUSG00000013858
• Gene ID - Rat: ENSRNOG00000012808
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM259 pAb (ATL-HPA042669) – 3 Found

Zhu, Bing; Jiang, LuLin; Huang, Timothy; Zhao, Yingjun; Liu, Tongfei; Zhong, Yongwang; Li, Xiaoguang; Campos, Alexandre; Pomeroy, Kenneth; Masliah, Eliezer; Zhang, Dongxian; Xu, Huaxi. ER-associated degradation regulates Alzheimer's amyloid pathology and memory function by modulating γ-secretase activity. Nature Communications. 2017;8(1):1472. 

Jiang, Lu-Lin; Zhu, Bing; Zhao, Yingjun; Li, Xiaoguang; Liu, Tongfei; Pina-Crespo, Juan; Zhou, Lisa; Xu, Wenxi; Rodriguez, Maria J; Yu, Haiyang; Cleveland, Don W; Ravits, John; Da Cruz, Sandrine; Long, Tao; Zhang, Dongxian; Huang, Timothy Y; Xu, Huaxi. Membralin deficiency dysregulates astrocytic glutamate homeostasis leading to ALS-like impairment. The Journal Of Clinical Investigation. 2019;129(8):3103-3120. 

van de Weijer, Michael L; Krshnan, Logesvaran; Liberatori, Sabrina; Guerrero, Elena Navarro; Robson-Tull, Jacob; Hahn, Lilli; Lebbink, Robert Jan; Wiertz, Emmanuel J H J; Fischer, Roman; Ebner, Daniel; Carvalho, Pedro. Quality Control of ER Membrane Proteins by the RNF185/Membralin Ubiquitin Ligase Complex. Molecular Cell. 2020;79(5):768-781.e7.