Anti TMEM246 pAb (ATL-HPA011318)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011318-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMEM246
Alternative Gene Name: C9orf125, MGC12992
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039611: 100%, ENSRNOG00000006800: 100%
Entrez Gene ID: 84302
Uniprot ID: Q9BRR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGFGKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL |
| Gene Sequence | RHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGFGKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL |
| Gene ID - Mouse | ENSMUSG00000039611 |
| Gene ID - Rat | ENSRNOG00000006800 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM246 pAb (ATL-HPA011318) | |
| Datasheet | Anti TMEM246 pAb (ATL-HPA011318) Datasheet (External Link) |
| Vendor Page | Anti TMEM246 pAb (ATL-HPA011318) at Atlas Antibodies |
| Documents & Links for Anti TMEM246 pAb (ATL-HPA011318) | |
| Datasheet | Anti TMEM246 pAb (ATL-HPA011318) Datasheet (External Link) |
| Vendor Page | Anti TMEM246 pAb (ATL-HPA011318) |