Anti TMEM221 pAb (ATL-HPA041580)

Atlas Antibodies

Catalog No.:
ATL-HPA041580-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 221
Gene Name: TMEM221
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043664: 57%, ENSRNOG00000018167: 55%
Entrez Gene ID: 100130519
Uniprot ID: A6NGB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCP
Gene Sequence RGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCP
Gene ID - Mouse ENSMUSG00000043664
Gene ID - Rat ENSRNOG00000018167
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM221 pAb (ATL-HPA041580)
Datasheet Anti TMEM221 pAb (ATL-HPA041580) Datasheet (External Link)
Vendor Page Anti TMEM221 pAb (ATL-HPA041580) at Atlas Antibodies

Documents & Links for Anti TMEM221 pAb (ATL-HPA041580)
Datasheet Anti TMEM221 pAb (ATL-HPA041580) Datasheet (External Link)
Vendor Page Anti TMEM221 pAb (ATL-HPA041580)