Anti TMEM208 pAb (ATL-HPA041868)

Atlas Antibodies

Catalog No.:
ATL-HPA041868-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 208
Gene Name: TMEM208
Alternative Gene Name: HSPC171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014856: 95%, ENSRNOG00000015974: 92%
Entrez Gene ID: 29100
Uniprot ID: Q9BTX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDV
Gene Sequence SYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDV
Gene ID - Mouse ENSMUSG00000014856
Gene ID - Rat ENSRNOG00000015974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM208 pAb (ATL-HPA041868)
Datasheet Anti TMEM208 pAb (ATL-HPA041868) Datasheet (External Link)
Vendor Page Anti TMEM208 pAb (ATL-HPA041868) at Atlas Antibodies

Documents & Links for Anti TMEM208 pAb (ATL-HPA041868)
Datasheet Anti TMEM208 pAb (ATL-HPA041868) Datasheet (External Link)
Vendor Page Anti TMEM208 pAb (ATL-HPA041868)