Anti TMEM205 pAb (ATL-HPA041504)

Atlas Antibodies

Catalog No.:
ATL-HPA041504-25
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, nuclear membrane & endoplasmic reticulum.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 205
Gene Name: TMEM205
Alternative Gene Name: MBC3205, UNQ501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040883: 77%, ENSRNOG00000011747: 87%
Entrez Gene ID: 374882
Uniprot ID: Q6UW68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYH
Gene Sequence RTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYH
Gene ID - Mouse ENSMUSG00000040883
Gene ID - Rat ENSRNOG00000011747
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM205 pAb (ATL-HPA041504)
Datasheet Anti TMEM205 pAb (ATL-HPA041504) Datasheet (External Link)
Vendor Page Anti TMEM205 pAb (ATL-HPA041504) at Atlas Antibodies

Documents & Links for Anti TMEM205 pAb (ATL-HPA041504)
Datasheet Anti TMEM205 pAb (ATL-HPA041504) Datasheet (External Link)
Vendor Page Anti TMEM205 pAb (ATL-HPA041504)
!