Anti TMEM196 pAb (ATL-HPA043163)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043163-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMEM196
Alternative Gene Name: MGC42090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048004: 94%, ENSRNOG00000037435: 96%
Entrez Gene ID: 256130
Uniprot ID: Q5HYL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTCRLASYEQRRMFSEREHSLHHSHEMAEKEITDNMSNGGPQLIFNGRV |
| Gene Sequence | LTCRLASYEQRRMFSEREHSLHHSHEMAEKEITDNMSNGGPQLIFNGRV |
| Gene ID - Mouse | ENSMUSG00000048004 |
| Gene ID - Rat | ENSRNOG00000037435 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM196 pAb (ATL-HPA043163) | |
| Datasheet | Anti TMEM196 pAb (ATL-HPA043163) Datasheet (External Link) |
| Vendor Page | Anti TMEM196 pAb (ATL-HPA043163) at Atlas Antibodies |
| Documents & Links for Anti TMEM196 pAb (ATL-HPA043163) | |
| Datasheet | Anti TMEM196 pAb (ATL-HPA043163) Datasheet (External Link) |
| Vendor Page | Anti TMEM196 pAb (ATL-HPA043163) |