Anti TMEM161B pAb (ATL-HPA044562)

Atlas Antibodies

Catalog No.:
ATL-HPA044562-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 161B
Gene Name: TMEM161B
Alternative Gene Name: MGC33214
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035762: 79%, ENSRNOG00000032414: 81%
Entrez Gene ID: 153396
Uniprot ID: Q8NDZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLGNHSWGIYPESISTLPVDNSLLSNSVYSELPSAEGKMKVTVTQITVALSSL
Gene Sequence TLGNHSWGIYPESISTLPVDNSLLSNSVYSELPSAEGKMKVTVTQITVALSSL
Gene ID - Mouse ENSMUSG00000035762
Gene ID - Rat ENSRNOG00000032414
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM161B pAb (ATL-HPA044562)
Datasheet Anti TMEM161B pAb (ATL-HPA044562) Datasheet (External Link)
Vendor Page Anti TMEM161B pAb (ATL-HPA044562) at Atlas Antibodies

Documents & Links for Anti TMEM161B pAb (ATL-HPA044562)
Datasheet Anti TMEM161B pAb (ATL-HPA044562) Datasheet (External Link)
Vendor Page Anti TMEM161B pAb (ATL-HPA044562)