Anti TMEM150A pAb (ATL-HPA019015)

Atlas Antibodies

Catalog No.: ATL-HPA019015-25

Protein Description: transmembrane protein 150A
Gene Name: TMEM150A
Alternative Gene Name: FLJ90024, TM6P1, TMEM150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102455: 91%, ENSRNOG00000061100: 91%
Entrez Gene ID: 129303
Uniprot ID: Q86TG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYP
• Gene Sequence: VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYP
• Gene ID - Mouse: ENSMUSG00000102455
• Gene ID - Rat: ENSRNOG00000061100
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.