Anti TMED7 pAb (ATL-HPA008960)

Atlas Antibodies

Catalog No.: ATL-HPA008960-25

Protein Description: transmembrane emp24 protein transport domain containing 7
Gene Name: TMED7
Alternative Gene Name: CGI-109, FLJ90481
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033184: 98%, ENSRNOG00000003691: 99%
Entrez Gene ID: 51014
Uniprot ID: Q9Y3B3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF
• Gene Sequence: ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF
• Gene ID - Mouse: ENSMUSG00000033184
• Gene ID - Rat: ENSRNOG00000003691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMED7 pAb (ATL-HPA008960) – 1 Found

Doyle, Sarah L; Husebye, Harald; Connolly, Dympna J; Espevik, Terje; O'Neill, Luke A J; McGettrick, Anne F. The GOLD domain-containing protein TMED7 inhibits TLR4 signalling from the endosome upon LPS stimulation. Nature Communications. 2012;3( 22426228):707.