Anti TMED2 pAb (ATL-HPA014060)

Atlas Antibodies

Catalog No.: ATL-HPA014060-25

Protein Description: transmembrane emp24 domain trafficking protein 2
Gene Name: TMED2
Alternative Gene Name: P24A, RNP24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029390: 100%, ENSRNOG00000001053: 100%
Entrez Gene ID: 10959
Uniprot ID: Q15363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEY
• Gene Sequence: DAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEY
• Gene ID - Mouse: ENSMUSG00000029390
• Gene ID - Rat: ENSRNOG00000001053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMED2 pAb (ATL-HPA014060) – 1 Found

Shi-Peng, Gong; Chun-Lin, Chen; Huan, Wu; Fan-Liang, Meng; Yong-Ning, Chen; Ya-Di, Zhang; Guang-Ping, Zhang; Ye-Ping, Cai. TMED2 promotes epithelial ovarian cancer growth. Oncotarget. 2017;8(55):94151-94165.