Anti TMC5 pAb (ATL-HPA042037 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042037-25

Protein Description: transmembrane channel-like 5
Gene Name: TMC5
Alternative Gene Name: FLJ13593
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030650: 39%, ENSRNOG00000036760: 42%
Entrez Gene ID: 79838
Uniprot ID: Q6UXY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGSLWGENDYPEGIEMASMEMANSYGHSLPGAPGSGYVNPAYVGESGPVH
• Gene Sequence: STWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGSLWGENDYPEGIEMASMEMANSYGHSLPGAPGSGYVNPAYVGESGPVH
• Gene ID - Mouse: ENSMUSG00000030650
• Gene ID - Rat: ENSRNOG00000036760
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMC5 pAb (ATL-HPA042037 w/enhanced validation) – 1 Found

Zhan, Cheng; Yan, Li; Wang, Lin; Sun, Yang; Wang, Xingxing; Lin, Zongwu; Zhang, Yongxing; Shi, Yu; Jiang, Wei; Wang, Qun. Identification of immunohistochemical markers for distinguishing lung adenocarcinoma from squamous cell carcinoma. Journal Of Thoracic Disease. 2015;7(8):1398-405.