Anti TM4SF1 pAb (ATL-HPA002823)

Atlas Antibodies

Catalog No.: ATL-HPA002823-25

Protein Description: transmembrane 4 L six family member 1
Gene Name: TM4SF1
Alternative Gene Name: L6, M3S1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027800: 75%, ENSRNOG00000015812: 77%
Entrez Gene ID: 4071
Uniprot ID: P30408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
• Gene Sequence: GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
• Gene ID - Mouse: ENSMUSG00000027800
• Gene ID - Rat: ENSRNOG00000015812
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.