Anti TIMM8B pAb (ATL-HPA041173)

Atlas Antibodies

Catalog No.:
ATL-HPA041173-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: translocase of inner mitochondrial membrane 8 homolog B (yeast)
Gene Name: TIMM8B
Alternative Gene Name: DDP2, FLJ21744, MGC102866, MGC117373, TIM8B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039016: 97%, ENSRNOG00000009888: 97%
Entrez Gene ID: 26521
Uniprot ID: Q9Y5J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG
Gene Sequence LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG
Gene ID - Mouse ENSMUSG00000039016
Gene ID - Rat ENSRNOG00000009888
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIMM8B pAb (ATL-HPA041173)
Datasheet Anti TIMM8B pAb (ATL-HPA041173) Datasheet (External Link)
Vendor Page Anti TIMM8B pAb (ATL-HPA041173) at Atlas Antibodies

Documents & Links for Anti TIMM8B pAb (ATL-HPA041173)
Datasheet Anti TIMM8B pAb (ATL-HPA041173) Datasheet (External Link)
Vendor Page Anti TIMM8B pAb (ATL-HPA041173)